PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G05930.1
Common NameT20M3.21
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 318aa    MW: 37356.5 Da    PI: 7.9509
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G05930.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B330.75.6e-102252722978
                  -..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT- CS
           B3  29 kkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegD 78 
                  +++ ++  +l d+++++W+v l  ++ ++ y+l+ GW++ vkan+Lk+gD
  AT1G05930.1 225 DETMGVGAILVDQRSQKWSVIL--KRWGQNYFLSCGWNDVVKANKLKAGD 272
                  3456677899************..888889******************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037542.8E-38158264IPR005508B3 domain-containing protein
Gene3DG3DSA:2.40.330.105.5E-18169293IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-15178290IPR015300DNA-binding pseudobarrel domain
CDDcd100174.36E-12179287No hitNo description
SMARTSM010192.3E-4180289IPR003340B3 DNA binding domain
PROSITE profilePS5086312.182201293IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MTTNDDDHAA ERNTMSMNYE LAATLSDEEQ RARKGKAKIV CKEEDHVFIK KKEKYEEESE  60
KREFFSHVPR KIRPALRYPQ PNFENPNGAS SSLNLPFEED YYMAEYYKKT ETINPPNPYH  120
QWSPSSFLTE YTHPRMLEVL HRCGFNRPVV TCYSRTAREM RWWLRQVMKD MRAEDLTLIL  180
EKTLSTTDVI TTTHGRFSMH FNRLISNDFL KPEERSILEE DTYNDETMGV GAILVDQRSQ  240
KWSVILKRWG QNYFLSCGWN DVVKANKLKA GDDICLWAFR CDGVLCFAMR QWRGILCFAL  300
VPPLTLRQSS SSNARRLC
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO223293620.0
Expression AtlasAT1G05930-
AtGenExpressAT1G05930-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G05930.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G05930
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankT20M30.0AC009999.2 Sequence of BAC T20M3 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172084.20.0uncharacterized protein
SwissprotQ9MA320.0Y1593_ARATH; B3 domain-containing protein At1g05930
TrEMBLD7KF941e-125D7KF94_ARALL; Putative uncharacterized protein
STRINGAT1G05930.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2731015
Publications ? help Back to Top
  1. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]
  2. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]